Tested Applications
Positive WB detected in | SH-SY5Y cells, mouse brain tissue, SW480 cells, U-251 cells, U-87 MG cells, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
84011-6-RR targets ABR in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag29522 Product name: Recombinant human ABR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_021962 Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK Predict reactive species |
Full Name | active BCR-related gene |
Calculated Molecular Weight | 98 kDa |
Observed Molecular Weight | 97-100 kDa |
GenBank Accession Number | NM_021962 |
Gene Symbol | ABR |
Gene ID (NCBI) | 29 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q12979 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABR (Active breakpoint cluster region-related protein) is the only protein known in humans and mice to share high homology with BCR (68% amino acid identity). BCR(Breakpoint cluster region) gene was originally identified due to its involvement in a specific chromosomal translocation that causes the development of chronic myeloid leukemia and a subset of acute lymphoblastic leukemia. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. (PMID: 17116687, PMID: 37507586)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ABR antibody 84011-6-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |