Tested Applications
| Positive WB detected in | rat skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84356-1-RR targets ACTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag36709 Product name: Recombinant human ACTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species |
| Full Name | actinin, alpha 3 |
| Calculated Molecular Weight | 901 aa, 103 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC099647 |
| Gene Symbol | ACTN3 |
| Gene ID (NCBI) | 89 |
| RRID | AB_3671894 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q08043 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha-actinin-3(ACTN3) is a member of the alpha-actin binding protein gene family. The members of this family are actin cross-linking proteins, among which ACTN2 and ACTN3 are muscle-specific subtypes. ACTN3 is primarily expressed in skeletal muscle and functions as a structural component of the sarcomeric Z line.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACTN3 antibody 84356-1-RR | Download protocol |
| IHC protocol for ACTN3 antibody 84356-1-RR | Download protocol |
| WB protocol for ACTN3 antibody 84356-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ACTN3 Recombinant monoclonal antibody (241168A5), catalog number 84356-1-RR, has 1 total citation. The cited publication appeared in the journal Biomolecules (2024) and investigated integrated proteomic and metabolomic analysis of muscle atrophy induced by hindlimb unloading in rat. The associated research fields include muscle physiology, proteomics, and metabolomics. The antibody was applied in WB and IF for rat samples in that study.
| Species | Application | Title |
|---|---|---|
Biomolecules Integrated Proteomic and Metabolomic Analysis of Muscle Atrophy Induced by Hindlimb Unloading. |
