Tested Applications
Positive WB detected in | rat skeletal muscle tissue |
Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
84356-1-RR targets ACTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag36709 Product name: Recombinant human ACTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species |
Full Name | actinin, alpha 3 |
Calculated Molecular Weight | 901 aa, 103 kDa |
Observed Molecular Weight | 100 kDa |
GenBank Accession Number | BC099647 |
Gene Symbol | ACTN3 |
Gene ID (NCBI) | 89 |
RRID | AB_3671894 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q08043 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ACTN3 antibody 84356-1-RR | Download protocol |
IHC protocol for ACTN3 antibody 84356-1-RR | Download protocol |
IF protocol for ACTN3 antibody 84356-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |