CoraLite® Plus 488-conjugated ACTN3 Recombinant monoclonal antibody

• 

  IF Staining of mouse skeletal muscle using CL488-84356

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using CoraLite® Plus 488 ACTN3 antibody (CL488-84356, Clone: 241168A5 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ACTN3 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-84356

Clone No.241168A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

241168A5, actinin, alpha 3, ACTN 3, Alpha actinin 3, Alpha-actinin skeletal muscle isoform 3

---

Tested Applications

• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84356 targets ACTN3 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36709

  Product name: Recombinant human ACTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 577-624 aa of BC099647

  Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL

• Full Name: actinin, alpha 3
• Calculated Molecular Weight: 901 aa, 103 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC099647
• Gene Symbol: ACTN3
• Gene ID (NCBI): 89
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08043
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.