Tested Applications
Positive WB detected in | A549 cells, LNCaP cells, MCF-7 cells, HEK-293 cells, HSC-T6 cells, 4T1 cells, PC-3 cells, HeLa cells, Caco-2 cells, HepG2 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human breast cancer tissue, mouse testis tissue |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 48 publications below |
IHC | See 6 publications below |
IF | See 10 publications below |
FC | See 1 publications below |
Product Information
67785-1-Ig targets AHR in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, zebrafish |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28935 Product name: Recombinant human AHR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-300 aa of BC070080 Sequence: PIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC Predict reactive species |
Full Name | aryl hydrocarbon receptor |
Calculated Molecular Weight | 848 aa, 96 kDa |
Observed Molecular Weight | 105-110 kDa |
GenBank Accession Number | BC070080 |
Gene Symbol | AHR |
Gene ID (NCBI) | 196 |
RRID | AB_2918549 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P35869 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The aryl hydrocarbon receptor (AhR) is a ligand-activated transcription factor that has been largely regarded as a mediator of xenobiotic metabolism [PMID:18483242]. It plays a part role in physiologic activities, including attenuation of the acute phase response, cytokine signaling, T helper (TH)17 immune cell differentiation, modulation of NF-κB activity, and regulation of hormonal signaling [PMID:20423157,18540824]. It also mediates transcription factor sequestering away from a gene promoter or tethering of the AhR to a transcription factor on a promoter. AHR calculated molecular masses differ by <10%, compared with the apparent molecular masses predicted from SDS-PAGE for the two receptors (105 and 95 kDa, respectively). (PMID: 8246913)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for AHR antibody 67785-1-Ig | Download protocol |
IHC protocol for AHR antibody 67785-1-Ig | Download protocol |
IF protocol for AHR antibody 67785-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Phytother Res Quercetin ameliorates ulcerative colitis by activating aryl hydrocarbon receptor to improve intestinal barrier integrity | ||
NPJ Regen Med Aryl hydrocarbon receptor regulates IL-22 receptor expression on thymic epithelial cell and accelerates thymus regeneration | ||
Cell Rep Hypoxia-induced PRMT1 methylates HIF2β to promote breast tumorigenesis via enhancing glycolytic gene transcription | ||
Ecotoxicol Environ Saf Hesperetin protects hippocampal neurons from the neurotoxicity of Aflatoxin B1 in mice | ||
Biomater Sci Glioma-targeted multifunctional nanoparticles to co-deliver camptothecin and curcumin for enhanced chemo-immunotherapy. | ||
iScience StemRegenin 1 attenuates the RANKL-induced osteoclastogenesis via inhibiting AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rashmi (Verified Customer) (10-13-2025) | The antibody worked well (1:100 dilution) with IFA on paraffin-embedded mouse lung tissue.
![]() |
FH Bartosz (Verified Customer) (02-09-2023) | Perfect Abs, the bands are clear and very strong, even in case of small of amount of protein, loaded into gel (20 ug). Just perfect, highly recommend.
|