Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, U-251 cells, MCF-7 cells, L-929 cells, C2C12 cells, C6 cells |
| Positive IF/ICC detected in | C6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84760-4-RR targets CAB39 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag36153 Product name: Recombinant human CAB39 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC020570 Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMK Predict reactive species |
| Full Name | calcium binding protein 39 |
| Observed Molecular Weight | 39-40 kDa |
| GenBank Accession Number | BC020570 |
| Gene Symbol | CAB39 |
| Gene ID (NCBI) | 51719 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9Y376 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CAB39 (Calcium-binding protein 39), also called MO25, is a component of the complex that binds and activates STK11/LKB1. It is required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (PMID: 19892943).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CAB39 antibody 84760-4-RR | Download protocol |
| WB protocol for CAB39 antibody 84760-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





