Use Able AI chat for product recommendations

FNDC5 Recombinant monoclonal antibody

FNDC5 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 82671-1-RR
Clone No.2H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Irisin, 2H3, Fibronectin type III domain-containing protein 5, Fibronectin type III repeat-containing protein 2, FRCP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, C2C12 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, pig skeletal muscle tissue, mouse stomach tissue, rat stomach tissue
Positive IHC detected inmouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

82671-1-RR targets FNDC5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29714

Product name: Recombinant human FNDC5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 103-153 aa of BC062297

Sequence: IIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW

Predict reactive species
Full Name fibronectin type III domain containing 5
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC062297
Gene Symbol FNDC5
Gene ID (NCBI) 252995
RRIDAB_3086499
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NAU1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

fibronectin type III domain containing 5(FNDC5) encodes 23 kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure.

Protocols

Product Specific Protocols
IHC protocol for FNDC5 antibody 82671-1-RRDownload protocol
WB protocol for FNDC5 antibody 82671-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Curr Issues Mol Biol

Effects of Aerobic Exercise on Irisin and Skeletal Muscle Autophagy in ApoE-/- Mice

Authors - Wenxin Wang
mouseWB

Front Aging Neurosci

Aerobic exercise and gut flora: a key link to improved cognitive impairment in mice with Parkinson's disease.

Authors - Wen Peng Shan

Biochim Biophys Acta Mol Basis Dis

The irisin-PINK1/Parkin axis plays an essential role in mediating microglial mitophagy: A crucial mechanism for exercise-induced neuroprotection against Parkinson's disease.

Authors - Bin Wang
Loading...
||
New chat

Able

正在加载,请稍候...