SMMHC Polyclonal antibody

SMMHC Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 21404-1-AP

Publications(76)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

MYH11, KIAA0866, Myosin 11, Myosin heavy chain 11, Myosin-11

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PIF/ICCFC (Intra)

WB analysis of mouse uterus using 21404-1-AP
mouse uterus tissue were subjected to SDS PAGE followed by western blot with 21404-1-AP (SMMHC antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 21404-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21404-1-AP (SMMHC antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat bladder using 21404-1-AP
Immunohistochemical analysis of paraffin-embedded rat bladder tissue slide using 21404-1-AP (SMMHC antibody) at dilution of 1:1000 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skeletal muscle using 21404-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 21404-1-AP (SMMHC antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse heart using 21404-1-AP
Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using SMMHC antibody (21404-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 21404-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SMMHC antibody (21404-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of C2C12 using 21404-1-AP
1X10^6 C2C12 cells were intracellularly stained with 0.4 ug Anti-Human SMMHC (21404-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (76)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse uterus tissue
Positive IHC detected in	human colon tissue, human skeletal muscle tissue, rat bladder tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse heart tissue
Positive IF/ICC detected in	HeLa cells
Positive FC (Intra) detected in	C2C12 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
Immunofluorescence (IF)-P	IF-P : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21404-1-AP targets SMMHC in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16114 Product name: Recombinant human MYH11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1208-1316 aa of BC104906 Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ Predict reactive species
Full Name	myosin, heavy chain 11, smooth muscle
Calculated Molecular Weight	1979 aa, 228 kDa
Observed Molecular Weight	220 kDa
GenBank Accession Number	BC104906
Gene Symbol	SMMHC/MYH11
Gene ID (NCBI)	4629
RRID	AB_10732819
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P35749
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.

Protocols

Product Specific Protocols
FC protocol for SMMHC antibody 21404-1-AP	Download protocol
IF protocol for SMMHC antibody 21404-1-AP	Download protocol
IHC protocol for SMMHC antibody 21404-1-AP	Download protocol
WB protocol for SMMHC antibody 21404-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	IF	Cancer Commun (Lond) Tryptophan 2,3-dioxygenase-positive matrix fibroblasts fuel breast cancer lung metastasis via kynurenine-mediated ferroptosis resistance of metastatic cells and T cell dysfunction Authors - Yongcan Liu View Article
mouse	IF	Nat Aging Senescent cells suppress innate smooth muscle cell repair functions in atherosclerosis. Authors - Bennett G Childs View Article
		Nat Commun Pericytes promote metastasis by regulating tumor local vascular tone and hemodynamics Authors - Xiaobo Li View Article
human	WB	Nat Commun Poly(ADP-ribose) polymerase 1 accelerates vascular calcification by upregulating Runx2. Authors - Cheng Wang View Article
mouse	WB	Redox Biol Activation of nuclear receptor pregnane-X-receptor protects against abdominal aortic aneurysm by inhibiting oxidative stress Authors - Zhi Shen View Article
mouse	WB	Theranostics Salvia miltiorrhiza-derived miRNAs suppress vascular remodeling through regulating OTUD7B/KLF4/NMHC IIA axis. Authors - Gao-Shan Yang View Article