Tested Applications
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-21404 targets SMMHC in IF/ICC, IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16114 Product name: Recombinant human MYH11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1208-1316 aa of BC104906 Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ Predict reactive species |
| Full Name | myosin, heavy chain 11, smooth muscle |
| Calculated Molecular Weight | 1979 aa, 228 kDa |
| Observed Molecular Weight | 200 kDa |
| GenBank Accession Number | BC104906 |
| Gene Symbol | SMMHC/MYH11 |
| Gene ID (NCBI) | 4629 |
| RRID | AB_3672731 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35749 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 SMMHC antibody CL488-21404 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



