Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, PC-3 cells, U-87 MG cells, C6 cells, NIH/3T3 cells, |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83377-1-RR targets RPL29 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34100 Product name: Recombinant human RPL29 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-97 aa of BC008926 Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA Predict reactive species |
| Full Name | ribosomal protein L29 |
| Calculated Molecular Weight | 159 aa, 18 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC008926 |
| Gene Symbol | RPL29 |
| Gene ID (NCBI) | 6159 |
| RRID | AB_3671030 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P47914 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ribosomal protein L29 (Rpl29) is a component of the large (60S) ribosomal subunit which is abundantly expressed in all cell types, plays a regulatory role in translation efficiency and is essential for protein synthesis (PMID: 17195189). In contrast to adult tissues, RPL29 displays a much more widespread pattern of expression throughout embryonic development, and high levels of RPL29 are found in all developing organs. Several reports showed that RPL29 expression is up-regulated in human carcinomas and constitutes a candidate marker for abnormal growth when overexpressed(PMID: 9788632, 10383165).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RPL29 antibody 83377-1-RR | Download protocol |
| IF protocol for RPL29 antibody 83377-1-RR | Download protocol |
| WB protocol for RPL29 antibody 83377-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









