CoraLite® Plus 488-conjugated RPL29 Recombinant monoclonal antibody

RPL29 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83377
Clone No.240062F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Large ribosomal subunit protein eL29, HUMRPL29, HIP, Cell surface heparin-binding protein HIP, 60S ribosomal protein L29

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83377 targets RPL29 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34100

Product name: Recombinant human RPL29 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-97 aa of BC008926

Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA

Predict reactive species
Full Name ribosomal protein L29
Calculated Molecular Weight 159 aa, 18 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC008926
Gene Symbol RPL29
Gene ID (NCBI) 6159
RRIDAB_3673242
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP47914
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ribosomal protein L29 (Rpl29) is a component of the large (60S) ribosomal subunit which is abundantly expressed in all cell types, plays a regulatory role in translation efficiency and is essential for protein synthesis (PMID: 17195189). In contrast to adult tissues, RPL29 displays a much more widespread pattern of expression throughout embryonic development, and high levels of RPL29 are found in all developing organs. Several reports showed that RPL29 expression is up-regulated in human carcinomas and constitutes a candidate marker for abnormal growth when overexpressed(PMID: 9788632, 10383165).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RPL29 antibody CL488-83377Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...