Product Information
83377-1-PBS targets RPL29 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34100 Product name: Recombinant human RPL29 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-97 aa of BC008926 Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA Predict reactive species |
| Full Name | ribosomal protein L29 |
| Calculated Molecular Weight | 159 aa, 18 kDa |
| GenBank Accession Number | BC008926 |
| Gene Symbol | RPL29 |
| Gene ID (NCBI) | 6159 |
| RRID | AB_3671030 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P47914 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Ribosomal protein L29 (Rpl29) is a component of the large (60S) ribosomal subunit which is abundantly expressed in all cell types, plays a regulatory role in translation efficiency and is essential for protein synthesis (PMID: 17195189). In contrast to adult tissues, RPL29 displays a much more widespread pattern of expression throughout embryonic development, and high levels of RPL29 are found in all developing organs. Several reports showed that RPL29 expression is up-regulated in human carcinomas and constitutes a candidate marker for abnormal growth when overexpressed(PMID: 9788632, 10383165).









