Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, HEK-293 cells, THP-1 cells, NCI-H1299 cells, RAW 264.7 cells |
| Positive IHC detected in | human breast cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, human liver cancer tissue |
| Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:300 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66822-1-Ig targets USP4 in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28297 Product name: Recombinant human USP4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 567-779 aa of BC125131 Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR Predict reactive species |
| Full Name | ubiquitin specific peptidase 4 (proto-oncogene) |
| Calculated Molecular Weight | 963 aa, 109 kDa |
| Observed Molecular Weight | 109 kDa |
| GenBank Accession Number | BC125131 |
| Gene Symbol | USP4 |
| Gene ID (NCBI) | 7375 |
| RRID | AB_2882165 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13107 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for USP4 antibody 66822-1-Ig | Download protocol |
| IF protocol for USP4 antibody 66822-1-Ig | Download protocol |
| IHC protocol for USP4 antibody 66822-1-Ig | Download protocol |
| WB protocol for USP4 antibody 66822-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody targets USP4 (catalog no. 66822-1-Ig), with a total of 14 citations. Citations appear in journals including Autophagy, Cell Death & Disease, Cancer Letters, Phytomedicine, Thorax, NPJ Breast Cancer, Clinical & Translational Medicine, Cell Reports, Scientific Reports, PLoS Genetics, PLoS ONE, and bioRxiv. Research fields span autophagy, multiple cancers (esophageal, colorectal, breast, lung, gastric, hepatocellular), ischemic stroke, lung inflammation, ferroptosis, lipid metabolism, and DNA repair during meiosis.
| Species | Application | Title |
|---|---|---|
Autophagy USP4 depletion-driven RAB7A ubiquitylation impairs autophagosome-lysosome fusion and aggravates periodontitis | ||
Cell Death Dis USP4 promotes the proliferation, migration, and invasion of esophageal squamous cell carcinoma by targeting TAK1 | ||
Cell Death Dis USP4-mediated CENPF deubiquitylation regulated tumor metastasis in colorectal cancer | ||
Cancer Lett LINC01186-mediated deubiquitination of ACSL4 reprograms lipid metabolism to increase autophagy-mediated angiogenesis in colorectal cancer.
| ||
Phytomedicine Vialinin A alleviates oxidative stress and neuronal injuries after ischaemic stroke by accelerating Keap1 degradation through inhibiting USP4-mediated deubiquitination | ||
Thorax USP4 controls neutrophil spreading through stabilising IQGAP1 during lung inflammation. |
