Home
Products
Primary Antibodies
USP4 Monoclonal antibody, PBS Only (Detector) (66822-1-PBS)

USP4 Monoclonal antibody, PBS Only (Detector)

Name: USP4 Monoclonal antibody, PBS Only (Detector), 100ug
Brand: Proteintech
SKU: 66822-1-PBS-100UG

USP4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 66822-1-PBS

Clone No. 1G11G8

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

1G11G8, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PFC (Intra)Cytometric bead array sample testCytometric bead array

WB analysis using 66822-1-Ig (same clone as 66822-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66822-1-Ig (USP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 66822-1-Ig (same clone as 66822-1-PBS)
HEK-293 cells and Jurkat cells were subjected to SDS PAGE followed by western blot with 66822-1-Ig (USP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66822-1-Ig (same clone as 66822-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 66822-1-Ig (same clone as 66822-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 66822-1-Ig (same clone as 66822-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 66822-1-Ig (same clone as 66822-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human breast cancer using 66822-1-Ig (same clone as 66822-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using USP4 antibody (66822-1-Ig, Clone: 1G11G8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human liver cancer using 66822-1-Ig (same clone as 66822-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using USP4 antibody (66822-1-Ig, Clone: 1G11G8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of THP-1 using 66822-1-Ig (same clone as 66822-1-PBS)
1X10^6 THP-1 cells were intracellularly stained with 0.4 ug Anti-Human USP4 (66822-1-Ig, Clone:1G11G8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b isotype control Mouse McAb (66360-3-Ig, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1X10^6 THP-1 cells were intracellularly stained with 0.4 ug Anti-Human USP4 (66822-1-Ig, Clone:1G11G8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b isotype control Mouse McAb (66360-3-Ig, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP51901-1
Cytometric bead array sample test of MP51901-1, USP4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66822-2-PBS. Detection antibody: 66822-1-PBS.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP51901-1
Cytometric bead array standard curve of MP51901-1, USP4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66822-2-PBS. Detection antibody: 66822-1-PBS. Standard:Ag28297. Range: 0.781-100 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP4 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66822-1-PBS targets USP4 as part of a matched antibody pair:

MP51901-1: 66822-2-PBS capture and 66822-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28297 Product name: Recombinant human USP4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 567-779 aa of BC125131 Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR Predict reactive species
Full Name	ubiquitin specific peptidase 4 (proto-oncogene)
Calculated Molecular Weight	963 aa, 109 kDa
Observed Molecular Weight	109 kDa
GenBank Accession Number	BC125131
Gene Symbol	USP4
Gene ID (NCBI)	7375
RRID	AB_2882165
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q13107
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a Deubiquitinating enzymes that links to mitogen-activated protein kinase signaling, pre-mRNA splicing and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).