USP4 Monoclonal antibody, PBS Only

• 

  WB analysis using 66822-1-Ig (same clone as 66822-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66822-1-Ig (USP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66822-1-Ig (same clone as 66822-1-PBS)

  HEK-293 cells and Jurkat cells were subjected to SDS PAGE followed by western blot with 66822-1-Ig (USP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66822-1-Ig (same clone as 66822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66822-1-Ig (same clone as 66822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66822-1-Ig (same clone as 66822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66822-1-Ig (same clone as 66822-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66822-1-Ig (USP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 66822-1-Ig (same clone as 66822-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using USP4 antibody (66822-1-Ig, Clone: 1G11G8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66822-1-Ig (same clone as 66822-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using USP4 antibody (66822-1-Ig, Clone: 1G11G8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

• 

  FC experiment of THP-1 using 66822-1-Ig (same clone as 66822-1-PBS)

  1X10^6 THP-1 cells were intracellularly stained with 0.4 ug Anti-Human USP4 (66822-1-Ig, Clone:1G11G8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2b isotype control Mouse McAb (66360-3-Ig, Clone: 11B8C4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66822-1-PBS in a different storage buffer formulation.

USP4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 66822-1-PBS

Clone No.1G11G8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

Synonyms

1G11G8, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP

---

Product Information

66822-1-PBS targets USP4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28297

  Product name: Recombinant human USP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 567-779 aa of BC125131

  Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

• Full Name: ubiquitin specific peptidase 4 (proto-oncogene)
• Calculated Molecular Weight: 963 aa, 109 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC125131
• Gene Symbol: USP4
• Gene ID (NCBI): 7375
• RRID: AB_2882165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13107
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP4, also named as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a Deubiquitinating enzymes that links to mitogen-activated protein kinase signaling, pre-mRNA splicing and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).