Tested Applications
| Positive WB detected in | LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells |
| Positive IF/ICC detected in | U2OS cells, HepG2 cells, MCF-7 cells |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68254-1-Ig targets ABL1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26152 Product name: Recombinant human ABL1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 801-900 aa of NM_005157 Sequence: MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP Predict reactive species |
| Full Name | c-abl oncogene 1, receptor tyrosine kinase |
| Calculated Molecular Weight | 123 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | NM_005157 |
| Gene Symbol | ABL1 |
| Gene ID (NCBI) | 25 |
| RRID | AB_2935339 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P00519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABL1, also named as ABL, JTK7, c-ABL and p150, belongs to the protein kinase superfamily, Tyr protein kinase family and ABL subfamily. ABL1 regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. ABL1 localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. It regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. ABL1 catalyze the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia (CML) [MIM:608232]. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL). The antibody is specific to ABL1.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ABL1 antibody 68254-1-Ig | Download protocol |
| IF protocol for ABL1 antibody 68254-1-Ig | Download protocol |
| WB protocol for ABL1 antibody 68254-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









