Tested Applications
| Positive WB detected in | rat cerebellum tissue, Rat heart tissue, Rat liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
68442-1-Ig targets ATP6 in WB, ELISA applications and shows reactivity with Human, Rat samples.
| Tested Reactivity | Human, Rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31940 Product name: Recombinant human ATP6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-68 aa of YP_003024031 Sequence: FPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTW Predict reactive species |
| Full Name | ATP synthase 6; ATPase subunit 6 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | YP_003024031 |
| Gene Symbol | ATP6 |
| Gene ID (NCBI) | 4508 |
| RRID | AB_3085155 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P00846 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP synthase, also known as FoF1 complex, is a critical mitochondrial OXPHOS enzyme involved in the regulation of mitochondrial ATP production and in the maintenance of the mitochondrial membrane potential. It is composed of three components (F1, Fo and the peripheral stalk). F1, the soluble catalytic core, is above the membrane, inside the matrix of the mitochondria; consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon); Fo, comprising the proton channel, is within the membrane; Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP6 is the a subunit of Fo region.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ATP6 antibody 68442-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hazard Mater ZLN005 alleviates PBDE-47 induced impairment of mitochondrial translation and neurotoxicity through PGC-1α/ERRα axis | ||
J Biol Chem Leber's hereditary optic neuropathy-associated ND1 3733G>C mutation ameliorates the mitochondrial quality control and cellular homeostasis | ||
Cell Commun Signal Mitochondrial ribosomal protein L12 mediates metabolic reorganization in clear cell renal cell carcinoma by regulating mitochondrial biosynthesis |

