Use Able AI chat for product recommendations

GINS1 Recombinant monoclonal antibody, PBS Only (Detector)

GINS1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83293-1-PBS
Clone No.240234A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

240234A2, GINS complex subunit 1, KIAA0186, PSF1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83293-1-PBS targets GINS1 as part of a matched antibody pair:

MP00317-2: 83293-2-PBS capture and 83293-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8895

Product name: Recombinant human GINS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC012542

Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS

Predict reactive species
Full Name GINS complex subunit 1 (Psf1 homolog)
Calculated Molecular Weight 196 aa, 23 kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberBC012542
Gene Symbol GINS1
Gene ID (NCBI) 9837
RRIDAB_3670960
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14691
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GINS1, also known as Partner of SLD Five 1 (PSF1) is a member of the GINS (Go-Ichi-Nii-San) complex, which plays a vital role in the initiation and elongation of DNA replication (PMID: 34414190). GINS1 was initially found to be predominantly expressed in highly proliferating cells instead of mature cells. Later on, it was found that GINS was involved in the tumorigenesis of various cancers, including breast cancer, colorectal cancer, and hepatocellular carcinoma (PMID: 36065190).

Loading...
||
New chat

Able

正在加载,请稍候...