Tested Applications
| Positive WB detected in | HEK-293T cells, HepG2 cells, THP-1 cells, HeLa cells, K-562 cells |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83605-6-RR targets SFRS11 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24932 Product name: Recombinant human SFRS11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 398-483 aa of BC040436 Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD Predict reactive species |
| Full Name | splicing factor, arginine/serine-rich 11 |
| Calculated Molecular Weight | 483 aa, 53 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC040436 |
| Gene Symbol | SFRS11 |
| Gene ID (NCBI) | 9295 |
| RRID | AB_3671218 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q05519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SRS11 (Serine/arginine-rich splicing factor 11) may function in pre-mRNA splicing. It is localized in the cell nucleus and can colocalize with spliceosome components.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SFRS11 antibody 83605-6-RR | Download protocol |
| WB protocol for SFRS11 antibody 83605-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









