CoraLite® Plus 488-conjugated SFRS11 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-83605-6

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 SFRS11 antibody (CL488-83605-6, Clone: 240465B8 ) at dilution of 1:200.

SFRS11 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83605-6

Clone No.240465B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

SRSF11, Splicing factor, arginine/serine-rich 11, Serine/arginine-rich splicing factor 11, p54, Arginine-rich 54 kDa nuclear protein

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83605-6 targets SFRS11 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24932

  Product name: Recombinant human SFRS11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 398-483 aa of BC040436

  Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD

• Full Name: splicing factor, arginine/serine-rich 11
• Calculated Molecular Weight: 483 aa, 53 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC040436
• Gene Symbol: SFRS11
• Gene ID (NCBI): 9295
• RRID: AB_3673280
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q05519
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SRS11 (Serine/arginine-rich splicing factor 11) may function in pre-mRNA splicing. It is localized in the cell nucleus and can colocalize with spliceosome components.