Use Able AI chat for product recommendations

Mouse CD300a Recombinant monoclonal antibody, PBS Only (Detector)

CD300a Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87050-1-PBS
Clone No.251972C10

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

CLM-8, CMRF35-like molecule 8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87050-1-PBS targets CD300a as part of a matched antibody pair:

MP03183-1: 87050-2-PBS capture and 87050-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2675

Product name: recombinant mouse Cd300a protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 28-183 aa of

Sequence: LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLR

Predict reactive species
Full Name CD300A antigen
Calculated Molecular Weight36 kDa
Observed Molecular Weight60-70 kDa
Gene Symbol Cd300a
Gene ID (NCBI) 217303
RRIDAB_3745301
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6SJQ0-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD300a is a transmembrane protein with an immunoglobulin (Ig)V-like extracellular domain and a cytoplasmic tail containing immunoreceptor tyrosine-based inhibitory motifs (ITIMs), providing the receptor with an inhibitory capacity. The relevance of the CD300a molecule in several pathological conditions has been highlighted by multiple studies. (PMID: 37762055)

Loading...
||
New chat

Able

正在加载,请稍候...