ABCE1 Polyclonal antibody

• 

  WB analysis using 28548-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28548-1-AP (ABCE1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 28548-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28548-1-AP (ABCE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 28548-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 28548-1-AP (ABCE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 28548-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28548-1-AP (ABCE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ABCE1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28548-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

RLI, OK/SW-cl.40, EC:3.6.5.-, ATP-binding cassette sub-family E member 1, 2'-5'-oligoadenylate-binding protein

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells, NCI-H1299 cells
• Positive IHC detected in: human breast cancer tissue, human ovary tumor tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

28548-1-AP targets ABCE1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29724

  Product name: Recombinant human ABCE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 319-436 aa of BC016283

  Sequence: TENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAY

• Full Name: ATP-binding cassette, sub-family E (OABP), member 1
• Calculated Molecular Weight: 599 aa, 67 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC016283
• Gene Symbol: ABCE1
• Gene ID (NCBI): 6059
• RRID: AB_2881169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61221
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC	Int Immunopharmacol; Restoration of miR-299-3p promotes macrophage phagocytosis and suppresses malignant phenotypes in breast cancer carcinogenesis via dual-targeting CD47 and ABCE1; Authors - Shoufang Tong ; KD Validated
human	WB	Res Sq; Translation stalling induced mitochondrial entrapment of ribosomal quality control related proteins offers cancer cell vulnerability; Authors - Rani Ojha
human	WB	PNAS Nexus; Ribosome stalling during c-myc translation presents actionable cancer cell vulnerability; Authors - Tejinder Pal Khaket
human	WB,IP	Autoimmun Rev; ABCE1: A new cytoplasmic autoantibody target in systemic sclerosis-associated interstitial lung disease; Authors - Jean-Baptiste Vulsteke
human	WB	J Clin Invest; CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes; Authors - Nunziata Maio