Tested Applications
Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells, NCI-H1299 cells |
Positive IHC detected in | human breast cancer tissue, human ovary tumor tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 5 publications below |
IHC | See 1 publications below |
IP | See 1 publications below |
Product Information
28548-1-AP targets ABCE1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29724 Product name: Recombinant human ABCE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 319-436 aa of BC016283 Sequence: TENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAY Predict reactive species |
Full Name | ATP-binding cassette, sub-family E (OABP), member 1 |
Calculated Molecular Weight | 599 aa, 67 kDa |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC016283 |
Gene Symbol | ABCE1 |
Gene ID (NCBI) | 6059 |
RRID | AB_2881169 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61221 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ABCE1 antibody 28548-1-AP | Download protocol |
IHC protocol for ABCE1 antibody 28548-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int Immunopharmacol Restoration of miR-299-3p promotes macrophage phagocytosis and suppresses malignant phenotypes in breast cancer carcinogenesis via dual-targeting CD47 and ABCE1
| ||
Res Sq Translation stalling induced mitochondrial entrapment of ribosomal quality control related proteins offers cancer cell vulnerability | ||
PNAS Nexus Ribosome stalling during c-myc translation presents actionable cancer cell vulnerability | ||
Autoimmun Rev ABCE1: A new cytoplasmic autoantibody target in systemic sclerosis-associated interstitial lung disease | ||
J Clin Invest CIAO1 loss of function causes a neuromuscular disorder with compromise of nucleocytoplasmic Fe-S enzymes |