Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
HRP-28548 targets ABCE1 in WB applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29724 Product name: Recombinant human ABCE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 319-436 aa of BC016283 Sequence: TENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAY Predict reactive species |
| Full Name | ATP-binding cassette, sub-family E (OABP), member 1 |
| Calculated Molecular Weight | 599 aa, 67 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC016283 |
| Gene Symbol | ABCE1 |
| Gene ID (NCBI) | 6059 |
| RRID | AB_2920510 |
| Conjugate | HRP |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61221 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HRP ABCE1 antibody HRP-28548 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

