Tested Applications
Positive WB detected in | A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
HRP-28548 targets ABCE1 in WB applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29724 Product name: Recombinant human ABCE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 319-436 aa of BC016283 Sequence: TENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAY Predict reactive species |
Full Name | ATP-binding cassette, sub-family E (OABP), member 1 |
Calculated Molecular Weight | 599 aa, 67 kDa |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC016283 |
Gene Symbol | ABCE1 |
Gene ID (NCBI) | 6059 |
RRID | AB_2920510 |
Conjugate | HRP |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61221 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for HRP ABCE1 antibody HRP-28548 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |