Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, MDA-MB-231 cells, Jurkat cells, MOLT-4 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 clls |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68490-1-Ig targets ABCF2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33824 Product name: Recombinant human ABCF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2-216 aa of BC001661 Sequence: PSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLG Predict reactive species |
| Full Name | ATP-binding cassette, sub-family F (GCN20), member 2 |
| Calculated Molecular Weight | 71 kDa |
| Observed Molecular Weight | 71 kDa |
| GenBank Accession Number | BC001661 |
| Gene Symbol | ABCF2 |
| Gene ID (NCBI) | 10061 |
| RRID | AB_3085201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UG63 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ABCF2 (ABC28, M-ABC1, HUSSY-18, EST133090, DKFZp586K1823) is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins are composed of transmembrane domains (TMDs), and nucleotide binding domains (NBDs, or ATP-binding cassettes, ABSs). Based on their sequence similarity scores, the members of the human ABC protein family can be grouped into eight subfamilies, including the MDR/TAP, the ALD, the MRP/CFTR, the ABC1, the White, the RNAseL inhibitor, the ANSA, and the GCN20 subfamilies. ABCF2 is a member of the GCN20 subfamily. ABC proteins transport various molecules across extra- and intracellular membranes.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ABCF2 antibody 68490-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

