ABCF2 Monoclonal antibody, PBS Only

ABCF2 Monoclonal Antibody for WB, ELISA
Cat No. 68490-1-PBS
Clone No.3E9C9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, ELISA

ABC28, ABCF2, DKFZp586K1823, EST133090, HUSSY 18, HUSSY18, M ABC1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68490-1-PBS targets ABCF2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33824

Product name: Recombinant human ABCF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2-216 aa of BC001661

Sequence: PSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLG

Predict reactive species
Full Name ATP-binding cassette, sub-family F (GCN20), member 2
Calculated Molecular Weight 71 kDa
Observed Molecular Weight 71 kDa
GenBank Accession NumberBC001661
Gene Symbol ABCF2
Gene ID (NCBI) 10061
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UG63
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ABCF2 (ABC28, M-ABC1, HUSSY-18, EST133090, DKFZp586K1823) is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins are composed of transmembrane domains (TMDs), and nucleotide binding domains (NBDs, or ATP-binding cassettes, ABSs). Based on their sequence similarity scores, the members of the human ABC protein family can be grouped into eight subfamilies, including the MDR/TAP, the ALD, the MRP/CFTR, the ABC1, the White, the RNAseL inhibitor, the ANSA, and the GCN20 subfamilies. ABCF2 is a member of the GCN20 subfamily. ABC proteins transport various molecules across extra- and intracellular membranes.

Loading...
||
New chat Able
正在加载,请稍候...