Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ACOX1 Monoclonal antibody

ACOX1 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 68017-1-Ig
Clone No.3E12E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, FC (Intra), ELISA

3E12E10, ACOX, ACOX 1, AOX, EC:1.3.3.6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, pig liver tissue, rat liver tissue, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68017-1-Ig targets ACOX1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28037

Product name: Recombinant human AOX protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 275-660 aa of BC010425

Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL

Predict reactive species
Full Name acyl-Coenzyme A oxidase 1, palmitoyl
Calculated Molecular Weight 74 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC010425
Gene Symbol ACOX1
Gene ID (NCBI) 51
RRIDAB_2918763
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15067
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD).

Protocols

Product Specific Protocols
FC protocol for ACOX1 antibody 68017-1-IgDownload protocol
IHC protocol for ACOX1 antibody 68017-1-IgDownload protocol
WB protocol for ACOX1 antibody 68017-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouse,humanWB,IHC,IF

Pharmacol Res

ACOX1 deficiency-induced lipid metabolic disorder facilitates chronic interstitial fibrosis development in renal allografts

Authors - Yang-He Zhang
  • KD Validated
ratWB,IF

Phytomedicine

An integrated network pharmacology and cell metabolomics approach to reveal the role of rhein, a novel PPARα agonist, against renal fibrosis by activating the PPARα-CPT1A axis.

Authors - Qiming Xiao

Biochem Pharmacol

Dual activation of PPARα/γ by bezafibrate triggers PINK1/Parkin-Mediated mitophagy to enhance lenvatinib sensitivity in hepatocellular carcinoma

Authors - Jian Wang
humanWB,IF

J Orthop Res

AMPK Signaling Pathway Regulates Tendon Regeneration via Fatty Acid Metabolism

Authors - Tianhao Wu
humanWB

Cell Death Dis

IGF2BP3/ESM1/KLF10/BECN1 positive feedback loop: a novel therapeutic target in ovarian cancer via lipid metabolism reprogramming

Authors - Anbo Gao
humanWB

Leukemia

Targeting ABCD1-ACOX1-MET/IGF1R axis suppresses multiple myeloma

Authors - Zhannan Han
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...