Beta Actin Monoclonal antibody

Beta Actin Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 60008-1-Ig
Clone No.7D2C10
Publications(3343)

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat, zebrafish, plant and More (8)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

ACTB, Actin, bate actin, β actin, Actin cytoplasmic 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmulti-cells/tissue, HeLa cells, MCF-7 cells, HEK-293 cells, A549 cells, rice whole plant tissue, arabidopsis whole plant tissue
Positive IHC detected inmouse heart tissue, human brain tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue
Positive IF/ICC detected inMDCK cells

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60008-1-Ig targets Beta Actin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish, plant samples.

Tested Reactivity human, mouse, rat, zebrafish, plant
Cited Reactivityhuman, rat, chicken, goat, yeast, tick, arabidopsis, terminalia bellirica, rare minnow, cat
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0297

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-167 aa of BC002409

Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
RRIDAB_2289225
Conjugate Unconjugated
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDP60709
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody can recognize all the actins.

Protocols

Product Specific Protocols
IF protocol for Beta Actin antibody 60008-1-IgDownload protocol
IHC protocol for Beta Actin antibody 60008-1-IgDownload protocol
WB protocol for Beta Actin antibody 60008-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,CoIP

Cell Res

Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression

Authors - Shiqiao Qiu
WB

Nature

A phase-separated nuclear GBPL circuit controls immunity in plants.

Authors - Shuai Huang
humanWB

Gastroenterology

PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis

Authors - Tian-Yi Jiang
mouseWB

Immunity

Microglial lipid phosphatase SHIP1 limits complement-mediated synaptic pruning in the healthy developing hippocampus

Authors - Alessandro Matera
humanIF

Nat Methods

Visualizing the native cellular organization by coupling cryofixation with expansion microscopy (Cryo-ExM).

Authors - Marine H Laporte
humanWB

Cell Metab

Microenvironmental ammonia enhances T cell exhaustion in colorectal cancer

Authors - Hannah N Bell

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

S (Verified Customer) (01-31-2026)

5

  • Applications: Western Blot
FH

Reyes (Verified Customer) (02-10-2025)

Beta actin (in green) did not seem to work on my human FFPE brain tissue. Appart from being really autofluorescent on the tissue, it seems to have a puncta-like staining on some cells, not the usual/expected clear cytoeskeleton staining.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
Beta Actin Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:60008-1-Ig)
FH

P (Verified Customer) (09-23-2024)

Excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 2000
  • Cell Tissue Type: HEK
Beta Actin Antibody Western Blot validation (2000 dilution) in HEK (Cat no:60008-1-Ig)
FH

Udesh (Verified Customer) (08-16-2023)

The Ab worked well for both WB and IF at mentioned dilutions

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 for WB and 1:200 for IF
  • Cell Tissue Type: Glioblastoma cells
FH

Chun (Verified Customer) (09-07-2020)

This is an excellent antibody for immunoblotting.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: HEK293, HeLa, HaCaT and SH-SY5Y cells
FH

Nikhil (Verified Customer) (09-17-2019)

Very good and specific. I can use 1:2500 5 ml antibody solution two times.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: Colon cancer cells
Beta Actin Antibody Western Blot, validation (1:2500 dilution) in Colon cancer cells (Cat no:60008-1-Ig)
FH

Leonardo (Verified Customer) (09-12-2019)

Excellent antibody. Works well since the first time.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:5,000
  • Cell Tissue Type: Human breast cancer (MDA-MB-231)
Beta Actin Antibody Western Blot, validation (1:5,000 dilution) in Human breast cancer (MDA-MB-231) (Cat no:60008-1-Ig)
FH

mark (Verified Customer) (02-05-2019)

Antibody works beautifully to detect a single Beta-actin band as a control

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: human cancer cells
Beta Actin Antibody Western Blot, validation (1:2000 dilution) in human cancer cells (Cat no:60008-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...