Beta Actin Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Beta Actin Monoclonal antibody, PBS Only (60008-1-PBS)

Beta Actin Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 60008-1-PBS Copied!

Clone No. 7D2C10

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat, zebrafish, plant

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

ACTB, Actin, bate actin, β actin, Actin cytoplasmic 1

• 

  WB analysis of multi-cells/tissue using 60008-1-Ig (same clone as 60008-1-PBS)

  Western blot analysis of Beta-actin in various tissues and cell lines using Proteintech antibody 60008-1-Ig at a dilution of 1:5000. Extra bands were detected in some species with unknown reason. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa cells using 60008-1-Ig (same clone as 60008-1-PBS)

  Western blot of Hela cell with anti-Actin-Beta (60008-1-Ig) at various dilutions. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of arabidopsis whole plant using 60008-1-Ig (same clone as 60008-1-PBS)

  arabidopsis whole plant tissue were subjected to SDS PAGE followed by western blot with 60008-1-Ig (beta actin Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 60008-1-Ig (same clone as 60008-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60008-1-Ig (ACTB antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 60008-1-Ig (same clone as 60008-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 60008-1-Ig (ACTB antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 60008-1-Ig (same clone as 60008-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60008-1-Ig (ACTB antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 60008-1-Ig (same clone as 60008-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 60008-1-Ig (ACTB antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rice whole plant using 60008-1-Ig (same clone as 60008-1-PBS)

  rice whole plant tissue were subjected to SDS PAGE followed by western blot with 60008-1-Ig (beta Actin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 60008-1-Ig (Beta Actin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60008-1-Ig (beta Actin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60008-1-Ig (beta Actin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 60008-1-Ig(ACTB antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat brain using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using Beta Actin antibody (60008-1-Ig, Clone: 7D2C10 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MDCK using 60008-1-Ig (same clone as 60008-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MDCK cells using Beta Actin antibody (60008-1-Ig, Clone: 7D2C10 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 60008-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Beta Actin in ?

Chat with Able

---

Product Information

60008-1-PBS targets Beta Actin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, zebrafish, plant samples.

• Tested Reactivity: human, mouse, rat, zebrafish, plant
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0297

  Product name: Recombinant human beta actin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-167 aa of BC002409

  Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE

• Full Name: actin, beta
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC002409
• Gene Symbol: Beta Actin
• Gene ID (NCBI): 60
• RRID: AB_2289225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P60709
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody can recognize all the actins.

Publications

What published studies show

Beta Actin Monoclonal antibody (7D2C10), catalog number 60008-1-PBS, has a total of 4,380 citations. The retrieved citation appears in Radiother Oncology (Impact Factor 5.8), published in 2026. The associated research field involves lung adenocarcinoma, specifically examining how ZIP10 drives radioresistance and malignant progression by inhibiting the Hippo pathway through a Zinc-LATS axis. The antibody was applied in Western Blotting for both mouse and human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Radiother Oncol; ZIP10 drives radioresistance and malignant progression in lung adenocarcinoma by inhibiting the Hippo pathway via a Zinc-LATS axis.; Authors - Lu Yang