Tested Applications
| Positive WB detected in | multi-cells/tissue, HeLa cells, MCF-7 cells, HEK-293 cells, A549 cells, rice whole plant tissue, arabidopsis whole plant tissue |
| Positive IHC detected in | mouse heart tissue, human brain tissue, human kidney tissue, human lung tissue, human ovary tissue, human placenta tissue, human spleen tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive IF/ICC detected in | MDCK cells |
Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3079 publications below |
| IHC | See 4 publications below |
| IF | See 11 publications below |
| IP | See 9 publications below |
| CoIP | See 3 publications below |
Product Information
60008-1-Ig targets Beta Actin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish, plant samples.
| Tested Reactivity | human, mouse, rat, zebrafish, plant |
| Cited Reactivity | human, rat, chicken, goat, yeast, tick, arabidopsis, terminalia bellirica, rare minnow, cat |
| Host / Isotype | Mouse / IgM |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0297 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-167 aa of BC002409 Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE Predict reactive species |
| Full Name | actin, beta |
| Calculated Molecular Weight | 375 aa, 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC002409 |
| Gene Symbol | Beta Actin |
| Gene ID (NCBI) | 60 |
| RRID | AB_2289225 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Caprylic acid/ammonium sulfate precipitation |
| UNIPROT ID | P60709 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Beta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody can recognize all the actins.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beta Actin antibody 60008-1-Ig | Download protocol |
| IHC protocol for Beta Actin antibody 60008-1-Ig | Download protocol |
| WB protocol for Beta Actin antibody 60008-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression | ||
Gastroenterology PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis | ||
Immunity Microglial lipid phosphatase SHIP1 limits complement-mediated synaptic pruning in the healthy developing hippocampus | ||
Nat Methods Visualizing the native cellular organization by coupling cryofixation with expansion microscopy (Cryo-ExM). | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH S (Verified Customer) (01-31-2026) | 5
|
FH Reyes (Verified Customer) (02-10-2025) | Beta actin (in green) did not seem to work on my human FFPE brain tissue. Appart from being really autofluorescent on the tissue, it seems to have a puncta-like staining on some cells, not the usual/expected clear cytoeskeleton staining.
![]() |
FH P (Verified Customer) (09-23-2024) | Excellent
![]() |
FH Udesh (Verified Customer) (08-16-2023) | The Ab worked well for both WB and IF at mentioned dilutions
|
FH Chun (Verified Customer) (09-07-2020) | This is an excellent antibody for immunoblotting.
|
FH Nikhil (Verified Customer) (09-17-2019) | Very good and specific. I can use 1:2500 5 ml antibody solution two times.
![]() |
FH Leonardo (Verified Customer) (09-12-2019) | Excellent antibody. Works well since the first time.
![]() |
FH mark (Verified Customer) (02-05-2019) | Antibody works beautifully to detect a single Beta-actin band as a control
![]() |






















































