Filter: AllWBIHCFC (Intra)

WB analysis of mouse heart using 23082-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 23082-1-AP (alpha Actin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human heart using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 23082-1-AP (alpha Actin antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human heart using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 23082-1-AP (alpha Actin antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human colon using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 23082-1-AP (Alpha Actin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human skeletal muscle using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 23082-1-AP (alpha Actin antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human skeletal muscle using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 23082-1-AP (alpha Actin antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human small intestine using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human small intestine using 23082-1-AP (alpha Actin antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human small intestine using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human small intestine using 23082-1-AP (alpha Actin antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human skeletal muscle using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 23082-1-AP (alpha Actin antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human skeletal muscle using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 23082-1-AP (alpha Actin antibody) at dilution of 1:50 (under 40x lens).
IHC staining of mouse skeletal muscle using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 23082-1-AP (alpha Actin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse skeletal muscle using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 23082-1-AP (alpha Actin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse heart using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23082-1-AP (alpha Actin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse heart using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 23082-1-AP (alpha Actin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse colon using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 23082-1-AP (alpha Actin antibody) at dilution of 1:200 (under 10x lens).
IHC staining of mouse colon using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 23082-1-AP (alpha Actin antibody) at dilution of 1:200 (under 40x lens).
IHC staining of human colon using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human colon using 23082-1-AP (alpha Actin antibody) at dilution of 1:100 (under 10x lens).
IHC staining of human colon using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human colon using 23082-1-AP (alpha Actin antibody) at dilution of 1:100 (under 40x lens).
IHC staining of human heart using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 23082-1-AP (alpha Actin antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human heart using 23082-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 23082-1-AP (alpha Actin antibody) at dilution of 1:50 (under 40x lens).
FC experiment of C2C12 using 23082-1-AP
1x10^6 C2C12 cells were intracellularly stained with 0.4 ug Alpha Actin Polyclonal antibody (23082-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Alpha cardiac muscle actin Polyclonal antibody

Name: Alpha cardiac muscle actin Polyclonal antibody
Brand: Proteintech
SKU: 23082-1-AP

Alpha cardiac muscle actin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 23082-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

ACTC1, Alpha actin, ACTC, ACTC 1, ACTC1 cardiac muscle 1

Formulation: PBS and Azide

PBS and Azide

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue
Positive IHC detected in	human normal colon, human colon tissue, human heart tissue, human skeletal muscle tissue, human small intestine tissue, mouse skeletal muscle tissue, mouse heart tissue, mouse colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive FC (Intra) detected in	C2C12 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:200-1:1000
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 1 publications below

Product Information

23082-1-AP targets Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19482 Product name: Recombinant human ACTC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC009978 Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species
Full Name	actin, alpha, cardiac muscle 1
Calculated Molecular Weight	377 aa, 42 kDa
Observed Molecular Weight	42-45 kDa
GenBank Accession Number	BC009978
Gene Symbol	ACTC1
Gene ID (NCBI)	70
RRID	AB_2879206
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P68032
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for Alpha cardiac muscle actin antibody 23082-1-AP	Download protocol
IHC protocol for Alpha cardiac muscle actin antibody 23082-1-AP	Download protocol
FC protocol for Alpha cardiac muscle actin antibody 23082-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
	WB	Circ Heart Fail Phenotype and Physiological Significance of the Endocardial Smooth Muscle Cells in Human Failing Hearts. Authors - Hideshi Okada View Article