AFF2 Polyclonal antibody

• 

  WB analysis using 25414-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25414-1-AP (AFF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of SH-SY5Y using 25414-1-AP

  IP result of anti-AFF2 (IP:25414-1-AP, 4ug; Detection:25414-1-AP 1:600) with SH-SY5Y cells lysate 1720 ug.

AFF2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25414-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

AF4/FMR2 family member 2, FMR2, FMR2P, FRAXE, MRX2

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IP detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25414-1-AP targets AFF2 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22225

  Product name: Recombinant human AFF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-263 aa of BC132683

  Sequence: LLTNHSNQNHLVGIPKNSVPQNPNNKNEPSFFPEQKNRIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNKMQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKEDSNPNSSGEDAFKEIFQSNSPEESEFAVQAPGSPLVASSLLAPSSGLSV

• Full Name: AF4/FMR2 family, member 2
• Calculated Molecular Weight: 1311 aa, 145 kDa
• Observed Molecular Weight: 145 kDa
• GenBank Accession Number: BC132683
• Gene Symbol: AFF2
• Gene ID (NCBI): 2334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51816
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AFF2 (OMIM* 300806) (also known as FMR2 gene), which encodes AF4/FMR2 family member 2, is a transcriptional factor and RNA-binding protein that plays an important role in transcriptional regulation, RNA splicing, mRNA processing, and nuclear speckle organization . AFF2 is highly conserved and abundantly expressed in human brain, being essential for brain development. Homozygous AFF2 knock-out mice showed abnormal central nervous system synaptic transmission, abnormal excitatory postsynaptic potential, and premature death (PMID: 35431806).