Use Able AI chat for product recommendations

AGR2 Monoclonal antibody

AGR2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66768-1-Ig
Clone No. 1A8A8
Publications (3)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

GOB 4, AGR 2, AG-2, AG2, AG 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for AGR2 in ?

Tested Applications

Positive WB detected inpig stomach tissue, T-47D cells, HT-29 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman colon cancer tissue
Positive IF/ICC detected inHT-29 cells, A549 cells
Positive FC (Intra) detected inHT-29 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66768-1-Ig targets AGR2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2919

Product name: Recombinant human AGR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 17-175 aa of BC015503

Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Predict reactive species
Full Name anterior gradient homolog 2 (Xenopus laevis)
Calculated Molecular Weight 175 aa, 20 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC015503
Gene Symbol AGR2
Gene ID (NCBI) 10551
RRIDAB_2882114
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95994
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used to aide in assessment of high-risk patients undergoing endoscopic procedures.

Protocols

Product Specific Protocols
FC protocol for AGR2 antibody 66768-1-IgDownload protocol
IF protocol for AGR2 antibody 66768-1-IgDownload protocol
IHC protocol for AGR2 antibody 66768-1-IgDownload protocol
WB protocol for AGR2 antibody 66768-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The AGR2 Monoclonal antibody (1A8A8), catalog number 66768-1-Ig, has 3 total citations. These appear in Molecular Cancer, International Journal of Biological Macromolecules, and Frontiers in Oncology. The associated research fields include breast cancer metastasis (epigenetic regulation of AGR2), colorectal cancer progression (macrophage M2 polarization), and non-small cell lung cancer (cell proliferation, migration, and EMT). All cited studies used human samples with WB or IHC applications.

SpeciesApplicationTitle
humanWB

Mol Cancer

LINC02273 drives breast cancer metastasis by epigenetically increasing AGR2 transcription.

Authors - Bingqiu Xiu
humanIHC

Int J Biol Macromol

GPX2 induces macrophage M2 polarization through the MIF signaling pathway to promote colorectal cancer progression.

Authors - Ming Qiu
humanWB

Front Oncol

QKI-6 Suppresses Cell Proliferation, Migration, and EMT in Non-Small Cell Lung Cancer.

Authors - Haihua Zhang
Loading...
||
New chat

Able™

正在加载,请稍候...