AGR2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• AGR2 Monoclonal antibody (66768-1-Ig)

AGR2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66768-1-Ig Copied!

Clone No. 1A8A8

Publications (3)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

GOB 4, AGR 2, AG-2, AG2, AG 2

• 

  WB analysis of pig stomach using 66768-1-Ig

  pig stomach tissue were subjected to SDS PAGE followed by western blot with 66768-1-Ig (AGR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of T-47D using 66768-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 66768-1-Ig (AGR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-29 using 66768-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66768-1-Ig (AGR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66768-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66768-1-Ig (AGR2 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66768-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66768-1-Ig (AGR2 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 66768-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using AGR2 antibody (66768-1-Ig, Clone: 1A8A8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 66768-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using AGR2 antibody (66768-1-Ig, Clone: 1A8A8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 66768-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using AGR2 antibody (66768-1-Ig, Clone: 1A8A8 ) at dilution of 1:1500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HT-29 using 66768-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HT-29 cells using AGR2 antibody (66768-1-Ig, Clone: 1A8A8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HT-29 using 66768-1-Ig

  1X10^6 HT-29 cells were intracellularly stained with 0.2 ug Anti-Human AGR2 (66768-1-Ig, Clone:1A8A8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), and 0.2 ug Mouse IgG2b Isotype Control (66360-3-Ig, Clone: K11B8C4B5) (blue). Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AGR2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig stomach tissue, T-47D cells, HT-29 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human colon cancer tissue
• Positive IF/ICC detected in: HT-29 cells, A549 cells
• Positive FC (Intra) detected in: HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66768-1-Ig targets AGR2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2919

  Product name: Recombinant human AGR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-175 aa of BC015503

  Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

• Full Name: anterior gradient homolog 2 (Xenopus laevis)
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC015503
• Gene Symbol: AGR2
• Gene ID (NCBI): 10551
• RRID: AB_2882114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95994
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used to aide in assessment of high-risk patients undergoing endoscopic procedures.

Publications

What published studies show

The AGR2 Monoclonal antibody (1A8A8), catalog number 66768-1-Ig, has 3 total citations. These appear in Molecular Cancer, International Journal of Biological Macromolecules, and Frontiers in Oncology. The associated research fields include breast cancer metastasis (epigenetic regulation of AGR2), colorectal cancer progression (macrophage M2 polarization), and non-small cell lung cancer (cell proliferation, migration, and EMT). All cited studies used human samples with WB or IHC applications.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; LINC02273 drives breast cancer metastasis by epigenetically increasing AGR2 transcription.; Authors - Bingqiu Xiu
human	IHC	Int J Biol Macromol; GPX2 induces macrophage M2 polarization through the MIF signaling pathway to promote colorectal cancer progression.; Authors - Ming Qiu
human	WB	Front Oncol; QKI-6 Suppresses Cell Proliferation, Migration, and EMT in Non-Small Cell Lung Cancer.; Authors - Haihua Zhang