CoraLite®594-conjugated AGR2 Monoclonal antibody

• 

  IF Staining of HT-29 using CL594-66768

  Immunofluorescent analysis of (-20°C Ethanol) fixed HT-29 cells using CoraLite®®594 AGR2 antibody (CL594-66768, Clone: 1A8A8 ) at dilution of 1:200.

AGR2 Monoclonal Antibody for IF/ICC

Cat No. CL594-66768

Clone No.1A8A8

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Pig

Applications

IF/ICC

Synonyms

AG 2, AG2, AGR2, GOB 4, HAG 2, HPC8, PDIA17, XAG 2

---

Tested Applications

• Positive IF/ICC detected in: HT-29 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66768 targets AGR2 in IF/ICC applications and shows reactivity with Human, Pig samples.

• Tested Reactivity: Human, Pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2919

  Product name: Recombinant human AGR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-175 aa of BC015503

  Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

• Full Name: anterior gradient homolog 2 (Xenopus laevis)
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC015503
• Gene Symbol: AGR2
• Gene ID (NCBI): 10551
• RRID: AB_2920033
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95994
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used to aide in assessment of high-risk patients undergoing endoscopic procedures.