CoraLite®594-conjugated AGR2 Monoclonal antibody

AGR2 Monoclonal Antibody for IF/ICC
Cat No. CL594-66768
Clone No.1A8A8

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Pig

Applications

IF/ICC

AG 2, AG2, AGR2, GOB 4, HAG 2, HPC8, PDIA17, XAG 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHT-29 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66768 targets AGR2 in IF/ICC applications and shows reactivity with Human, Pig samples.

Tested Reactivity Human, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2919

Product name: Recombinant human AGR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 17-175 aa of BC015503

Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Predict reactive species
Full Name anterior gradient homolog 2 (Xenopus laevis)
Calculated Molecular Weight 175 aa, 20 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC015503
Gene Symbol AGR2
Gene ID (NCBI) 10551
RRIDAB_2920033
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95994
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used to aide in assessment of high-risk patients undergoing endoscopic procedures.

Protocols

Product Specific Protocols
IF protocol for CL594 AGR2 antibody CL594-66768Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...