Tested Applications
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67484 targets AHCYL2 in IF/ICC applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19614 Product name: Recombinant human AHCYL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-115 aa of BC024325 Sequence: MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEA Predict reactive species |
| Full Name | S-adenosylhomocysteine hydrolase-like 2 |
| Calculated Molecular Weight | 611 aa, 67 kDa |
| Observed Molecular Weight | 67 and 57 kDa |
| GenBank Accession Number | BC024325 |
| Gene Symbol | AHCYL2 |
| Gene ID (NCBI) | 23382 |
| RRID | AB_2920144 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96HN2 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 AHCYL2 antibody CL594-67484 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

