Tested Applications
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-68401 targets AMOTL2 in IF/ICC applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19971 Product name: Recombinant human AMOTL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 340-466 aa of BC011454 Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI Predict reactive species |
| Full Name | angiomotin like 2 |
| Calculated Molecular Weight | 779 aa, 86 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC011454 |
| Gene Symbol | AMOTL2 |
| Gene ID (NCBI) | 51421 |
| RRID | AB_3673006 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y2J4 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 AMOTL2 antibody CL488-68401 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

