Use Able AI chat for product recommendations

Apolipoprotein A II/APOA2 Polyclonal antibody

Apolipoprotein A II/APOA2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

APOA2, apolipoprotein A II, ApoA-II, Apo-AII, ApoA II

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Apolipoprotein A II/APOA2 in ?

Tested Applications

Positive WB detected inhuman plasma tissue
Positive IP detected inhuman plasma tissue
Positive IHC detected inhuman liver tissue, human colon tissue, human hepatocirrhosis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16845-1-AP targets Apolipoprotein A II/APOA2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9863

Product name: Recombinant human APOA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC005282

Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Predict reactive species
Full Name apolipoprotein A-II
Calculated Molecular Weight 100 aa, 11 kDa
Observed Molecular Weight 7-9 kDa (monomer), 15 kDa (dimer)
GenBank Accession NumberBC005282
Gene Symbol APOA2
Gene ID (NCBI) 336
RRIDAB_2878324
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02652
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802)

Protocols

Product Specific Protocols
IF protocol for Apolipoprotein A II/APOA2 antibody 16845-1-APDownload protocol
IHC protocol for Apolipoprotein A II/APOA2 antibody 16845-1-APDownload protocol
IP protocol for Apolipoprotein A II/APOA2 antibody 16845-1-APDownload protocol
WB protocol for Apolipoprotein A II/APOA2 antibody 16845-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The APOA2 Polyclonal Antibody (Cat# 16845-1-AP) has 5 citations published in Nature Communications, Cell Death Discovery, Science China Life Sciences, International Journal of Molecular Sciences, and Experimental Cell Research. Research fields span liver tumourigenesis and cholesterol metabolism, cancer lipid reprogramming and antiangiogenic resistance, immune checkpoint inhibitor-associated cardiotoxicity, reverse cholesterol transport via FcRn signaling, and extracellular vesicle-mediated endometriosis progression.

SpeciesApplicationTitle
humanWB

Nat Commun

N1-methyladenosine methylation in tRNA drives liver tumourigenesis by regulating cholesterol metabolism.

Authors - Yanying Wang
humanIHC

Cell Death Discov

APOA2-mediated endothelial mesenchymal transition and cancer lipid metabolism reprogramming confers antiangiogenic drug resistance through TGF-β.

Authors - Su Zhang
mouseWB,IHC,IF

Sci China Life Sci

Nicotinamide prevents anti-PD1 immune checkpoint inhibitor-associated early stages of cardiotoxicity.

Authors - Lu Bai
human,mouseWB

Int J Mol Sci

Recombinant Humanized IgG1 Antibody Promotes Reverse Cholesterol Transport through FcRn-ERK1/2-PPARα Pathway in Hepatocytes

Authors - Zhonghao Li
humanWB

Exp Cell Res

Extracellular vesicle-mediated transfer of the lncRNA-TC0101441 promotes endometriosis migration/invasion.

Authors - Jun-Jun Qiu
Loading...
||
New chat

Able™

正在加载,请稍候...