Tested Applications
Positive WB detected in | human plasma tissue |
Positive IP detected in | human plasma tissue |
Positive IHC detected in | human liver tissue, human colon tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
16845-1-AP targets Apolipoprotein A II/APOA2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9863 Product name: Recombinant human APOA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC005282 Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Predict reactive species |
Full Name | apolipoprotein A-II |
Calculated Molecular Weight | 100 aa, 11 kDa |
Observed Molecular Weight | 7-9 kDa (monomer), 15 kDa (dimer) |
GenBank Accession Number | BC005282 |
Gene Symbol | APOA2 |
Gene ID (NCBI) | 336 |
RRID | AB_2878324 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P02652 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Apolipoprotein A II/APOA2 antibody 16845-1-AP | Download protocol |
IHC protocol for Apolipoprotein A II/APOA2 antibody 16845-1-AP | Download protocol |
IF protocol for Apolipoprotein A II/APOA2 antibody 16845-1-AP | Download protocol |
IP protocol for Apolipoprotein A II/APOA2 antibody 16845-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun N1-methyladenosine methylation in tRNA drives liver tumourigenesis by regulating cholesterol metabolism. | ||
Exp Cell Res Extracellular vesicle-mediated transfer of the lncRNA-TC0101441 promotes endometriosis migration/invasion. | ||
Int J Mol Sci Recombinant Humanized IgG1 Antibody Promotes Reverse Cholesterol Transport through FcRn-ERK1/2-PPARα Pathway in Hepatocytes |