CoraLite® Plus 488-conjugated Apolipoprotein A II/APOA2 Polyclonal antibody

Apolipoprotein A II/APOA2 Polyclonal Antibody for IF/ICC
Cat No. CL488-16845

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

APOA2, apolipoprotein A II, ApoA-II, Apo-AII, ApoA II

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16845 targets Apolipoprotein A II/APOA2 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9863

Product name: Recombinant human APOA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC005282

Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Predict reactive species
Full Name apolipoprotein A-II
Calculated Molecular Weight 100 aa, 11 kDa
Observed Molecular Weight 7-9 kDa (monomer), 15 kDa (dimer)
GenBank Accession NumberBC005282
Gene Symbol APOA2
Gene ID (NCBI) 336
RRIDAB_3672662
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02652
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Apolipoprotein A II/APOA2 antibody CL488-16845Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...