CoraLite® Plus 488-conjugated APOD Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66215

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 APOD antibody (CL488-66215, Clone: 1C6D10 ) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-66215

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human APOD (CL488-66215, Clone:1C6D10) (red), or 0.4 ug CoraLite® Plus 488 Mouse IgG1 Isotype Control (MOPC-21) (CL488-65124, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

APOD Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66215

Clone No.1C6D10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

1C6D10, Apo D, Apo-D, apolipoprotein D

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66215 targets APOD in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21422

  Product name: Recombinant human APOD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 15-189 aa of BC007402

  Sequence: FGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

• Full Name: apolipoprotein D
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 30-33 kDa
• GenBank Accession Number: BC007402
• Gene Symbol: APOD
• Gene ID (NCBI): 347
• RRID: AB_2919301
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05090
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Apolipoprotein D (ApoD) is a member of the lipocalin superfamily of ligand transporters, and has been implicated in the transport of small hydrophobic molecules. ApoD is also a component of plasma high-density lipoproteins (HDL). Alteration of ApoD expression has been linked to multiple neurological disorders, including Alzheimer's disease.