Product Information
87393-1-PBS targets ARPC1B as part of a matched antibody pair:
MP02990-1: 87393-1-PBS capture and 87393-3-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29001 Product name: Recombinant human ARPC1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 265-372 aa of BC007555 Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK Predict reactive species |
| Full Name | actin related protein 2/3 complex, subunit 1B, 41kDa |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC007555 |
| Gene Symbol | ARPC1B |
| Gene ID (NCBI) | 10095 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O15143 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.













