ARPC1B Recombinant monoclonal antibody

• 

  WB analysis of HEK-293T using 87393-1-RR

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 87393-1-RR (ARPC1B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87393-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87393-1-RR (ARPC1B antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 87393-1-RR

  WB result of ARPC1B antibody (87393-1-RR; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARPC1B transfected HeLa cells.

• 

  IP experiment of HeLa using 87393-1-RR

  IP result of anti-ARPC1B (IP:87393-1-RR, 4ug; Detection:87393-1-RR 1:5000) with HeLa cells lysate 1200 ug.

• 

  Affinity of 87393-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87393-1-RR against Human ARPC1B were performed. The affinity constant is 0.439 nM.

• KD/KO Validated

ARPC1B Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 87393-1-RR

Clone No.252807F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

Actin-related protein 2/3 complex subunit 1B, ARC41, p41 ARC, p41-ARC

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, rat spleen tissue, mouse spleen tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87393-1-RR targets ARPC1B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29001

  Product name: Recombinant human ARPC1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-372 aa of BC007555

  Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK

• Full Name: actin related protein 2/3 complex, subunit 1B, 41kDa
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC007555
• Gene Symbol: ARPC1B
• Gene ID (NCBI): 10095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15143
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy.