CoraLite® Plus 488-conjugated ASCT2 Polyclonal antibody

• 

  IF Staining of mouse small intestine using CL488-20350

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using CoraLite® Plus 488 ASCT2 antibody (CL488-20350) at dilution of 1:100, Villin antibody (16488-1-AP, Magenta), CoraLite® Plus 594 ZG16 antibody (CL594-67389, Clone: 1A7B9, red).

• 

  IF Staining of mouse small intestine using CL488-20350

  Immunofluorescent analysis of (4% PFA) fixed mouse small intestine tissue using CoraLite® Plus 488 ASCT2 antibody (CL488-20350) at dilution of 1:100, Villin antibody (16488-1-AP, Magenta), CoraLite® Plus 594 ZG16 antibody (CL594-67389, Clone: 1A7B9, red).

• 

  IF Staining of HEK-293 using CL488-20350

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 ASCT2 antibody (CL488-20350) at dilution of 1:200.

• 

  IF Staining of HEK-293 using CL488-20350

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 ASCT2 antibody (CL488-20350) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-20350

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human ASCT2 (CL488-20350) (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

ASCT2 Polyclonal Antibody for IF/ICC, IF-P, FC (Intra)

Cat No. CL488-20350

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, IF-P, FC (Intra)

Synonyms

SLC1A5/ASCT2, SLC1A5, AAAT, ATB(0), ATBO

---

Tested Applications

• Positive IF-P detected in: mouse small intestine tissue
• Positive IF/ICC detected in: HEK-293 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20350 targets ASCT2 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14182

  Product name: Recombinant human RDRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 436-541 aa of BC000062

  Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM

• Full Name: solute carrier family 1 (neutral amino acid transporter), member 5
• Calculated Molecular Weight: 541 aa, 57 kDa
• Observed Molecular Weight: 55-70 kDa
• GenBank Accession Number: BC000062
• Gene Symbol: SLC1A5/ASCT2
• Gene ID (NCBI): 6510
• RRID: AB_3084033
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15758
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SLC1A5 (Solute Carrier Family 1, member 5), also named as ASCT2, a major glutamine transporter belonging to the SLC1 family and localized in the plasma membrane of several body districts. Consistent with the functions exerted by glutamine, SLC1A5 is involved in uptake of essential amino acids, activation of mTORC1 and glutamine-dependent tumor cell survival and growth. SLC1A5 is highly expressed in various malignancies and plays a critical role in the transformation, growth and survival of cancer cells (PMID: 30234109). High SLC1A5 expression is associated with poor prognosis in clear-cell renal cell carcinoma (PMID: 26599282).