Tested Applications
| Positive WB detected in | HeLa cells, LNCaP cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human ovary tumor tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
66671-1-Ig targets ASF/SF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3626 Product name: Recombinant human ASF/SF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC010264 Sequence: MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT Predict reactive species |
| Full Name | splicing factor, arginine/serine-rich 1 |
| Calculated Molecular Weight | 248 aa, 28 kDa |
| Observed Molecular Weight | 32 kDa, 28 kDa, 22 kDa |
| GenBank Accession Number | BC010264 |
| Gene Symbol | ASF/SF2 |
| Gene ID (NCBI) | 6426 |
| RRID | AB_2882025 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q07955 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SFRS1, also named as ASF, SF2, SF2P33, SFRS1 and ASF-1, belongs to the splicing factor SR family. It plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. SFRS1 interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. This antibody can recognize all the 3 isoforms(28kd,33kd and 22kd) of SFRS1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ASF/SF2 antibody 66671-1-Ig | Download protocol |
| IHC protocol for ASF/SF2 antibody 66671-1-Ig | Download protocol |
| IP protocol for ASF/SF2 antibody 66671-1-Ig | Download protocol |
| WB protocol for ASF/SF2 antibody 66671-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
bioRxiv Long-read sequencing and profiling of RNA-binding proteins reveals the pathogenic mechanism of aberrant splicing of an SCN1A poison exon in epilepsy | ||
Mol Cancer Long non-coding RNA AFAP1-AS1 promotes alternative splicing of AXIN2 by facilitating SRSFs phase separation to induce drug resistance in lung adenocarcinoma | ||
Acta Biochim Biophys Sin (Shanghai) PRMT1 alleviates isoprenaline-induced myocardial hypertrophy by methylating SRSF1 | ||
J Virol VP3 protein of Senecavirus A promotes viral IRES-driven translation and attenuates innate immunity by specifically relocalizing hnRNPA2B1 | ||
bioRxiv SRSF1 regulates polyadenylation site selection independently of and through coordination with U1 snRNP.
| ||
Oncogene Emerging roles of RNA-binding protein hnRNPM in alternative splicing regulation and UTMD mediated sh-hnRNPM/CMBs suppress the proliferation of colorectal cancer. |



















