Tested Applications
| Positive WB detected in | HepG2 cells, human placenta tissue, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue, human small intestine tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 58 publications below |
| IHC | See 7 publications below |
| IF | See 18 publications below |
| ChIP | See 3 publications below |
Product Information
60035-1-Ig targets ATF4 in WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1279 Product name: Recombinant human ATF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC022088 Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP Predict reactive species |
| Full Name | activating transcription factor 4 (tax-responsive enhancer element B67) |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC022088 |
| Gene Symbol | ATF4 |
| Gene ID (NCBI) | 468 |
| RRID | AB_2058598 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P18848 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
What is the molecular weight of ATF4?
The molecular weight of ATF is 38.6 kD.
What is ATF4?
Activating transcription factor 4 (ATF4), also known as cAMP-response element-binding protein 2 (CREB2), is a substrate of RSK2 and a basic leucine-zipper transcription factor (PMIDs: 16000305, 17485283).
What the function of ATF4?
ATF4 its a transcription factor that controls the transcriptional activity of mature osteoblasts. ATF4 is particularly critical for their timely onset and terminal differentiation, as well as expression of Bsp and osteocalcin. Knockout animals displayed reduction or delay in bone mineralization and have severely reduced bone volume. ATF4 is also part of the PERK-eIF2α-ATF4-CHOP apoptosis pathway, which is activated by ER stress, and it likely plays a role related to tumor cell survival (PMIDs: 18083928, 16000305, 30134550).
What is the effect of ATF4 interaction with RSK2?
ATF4 and RSK2 posttranscriptionally regulate type I collagen synthesis. Lack of RSK2 phosphorylation of AFT4 may contribute to skeletal phenotypes associated with Coffin-Lowry Syndrome (PMID: 17485283).
Where is ATF4 expressed?
ATF4 protein is predominantly expressed in osteoblasts, although its corresponding Atf4 mRNA is ubiquitously expressed (PMID: 16000305).
What regulates ATF4 expression?
ATF4 is regulated by a ubiquitin/proteasomal pathway, which is less active in osteoblasts by inhibition with MG115 (PMID: 16000305).
How does ATF4 expression affect Ocn mRNA?
Inhibition of the degradation pathway leads to ATF4 accumulation and induces Ocn mRNA expression in non-osteoblastic cells (PMID: 16000305).
Does ATF4 have the ability to induce osteoblast-specific gene expression even in non-osteoblastic cells?
Yes, ATF4, as well as other osteoblast differentiation factors, has this ability. AFT4 interactions with Runx2 can stimulate osteoblast-specific osteocalcin gene expression. (PMIDs: 16000305, 17485283)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ATF4 antibody 60035-1-Ig | Download protocol |
| IF protocol for ATF4 antibody 60035-1-Ig | Download protocol |
| IHC protocol for ATF4 antibody 60035-1-Ig | Download protocol |
| WB protocol for ATF4 antibody 60035-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Disrupted methionine cycle triggers muscle atrophy in cancer cachexia through epigenetic regulation of REDD1 | ||
Nat Commun Moderate-intensity interval exercise exacerbates cardiac lipotoxicity in high-fat, high-calories diet-fed mice | ||
Adv Sci (Weinh) The Critical Role of The Piezo1/β-catenin/ATF4 Axis on The Stemness of Gli1+ BMSCs During Simulated Microgravity-Induced Bone Loss | ||
J Clin Invest ATF4-dependent induction of heme oxygenase 1 prevents anoikis and promotes metastasis. | ||
Aging Cell Reducing ER stress with chaperone therapy reverses sleep fragmentation and cognitive decline in aged mice. | ||
Nat Commun Integration of Hippo signalling and the unfolded protein response to restrain liver overgrowth and tumorigenesis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Morgane (Verified Customer) (10-15-2025) | Works well on Total extract, two bands can be detected. Migration is a little higher than expected
![]() |
FH ARUNASALAM (Verified Customer) (10-02-2025) | This ATF4 antibody works well in IHC staining at 1:500 dilution with minimal background on tumor tissues.
|
FH Daniel (Verified Customer) (12-02-2019) | Multiple bands appeared which were higher than the expected ~50kDa.
![]() |









































