• Featured Product
  • KD/KO Validated

ATF4 Monoclonal antibody

ATF4 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 60035-1-Ig
Clone No.3E4C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA

3E4C5, cAMP-dependent transcription factor ATF-4, CREB2, Cyclic AMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, human placenta tissue, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman pancreas cancer tissue, human breast cancer tissue, human small intestine tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60035-1-Ig targets ATF4 in WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1279

Product name: Recombinant human ATF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC022088

Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predict reactive species
Full Name activating transcription factor 4 (tax-responsive enhancer element B67)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC022088
Gene Symbol ATF4
Gene ID (NCBI) 468
RRIDAB_2058598
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18848
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of ATF4?

The molecular weight of ATF is 38.6 kD.

 

What is ATF4?

Activating transcription factor 4 (ATF4), also known as cAMP-response element-binding protein 2 (CREB2), is a substrate of RSK2 and a basic leucine-zipper transcription factor (PMIDs: 16000305, 17485283).

 

What the function of ATF4?

ATF4 its a transcription factor that controls the transcriptional activity of mature osteoblasts. ATF4 is particularly critical for their timely onset and terminal differentiation, as well as expression of Bsp and osteocalcin. Knockout animals displayed reduction or delay in bone mineralization and have severely reduced bone volume. ATF4 is also part of the PERK-eIF2α-ATF4-CHOP apoptosis pathway, which is activated by ER stress, and it likely plays a role related to tumor cell survival (PMIDs: 18083928, 16000305, 30134550).

 

What is the effect of ATF4 interaction with RSK2?

ATF4 and RSK2 posttranscriptionally regulate type I collagen synthesis. Lack of RSK2 phosphorylation of AFT4 may contribute to skeletal phenotypes associated with Coffin-Lowry Syndrome (PMID: 17485283).

 

Where is ATF4 expressed?

ATF4 protein is predominantly expressed in osteoblasts, although its corresponding Atf4 mRNA is ubiquitously expressed (PMID: 16000305).

 

What regulates ATF4 expression?

ATF4 is regulated by a ubiquitin/proteasomal pathway, which is less active in osteoblasts by inhibition with MG115 (PMID: 16000305).

 

How does ATF4 expression affect Ocn mRNA?

Inhibition of the degradation pathway leads to ATF4 accumulation and induces Ocn mRNA expression in non-osteoblastic cells (PMID: 16000305).

 

Does ATF4 have the ability to induce osteoblast-specific gene expression even in non-osteoblastic cells?

Yes, ATF4, as well as other osteoblast differentiation factors, has this ability. AFT4 interactions with Runx2 can stimulate osteoblast-specific osteocalcin gene expression. (PMIDs: 16000305, 17485283)


Protocols

Product Specific Protocols
FC protocol for ATF4 antibody 60035-1-IgDownload protocol
IF protocol for ATF4 antibody 60035-1-IgDownload protocol
IHC protocol for ATF4 antibody 60035-1-IgDownload protocol
WB protocol for ATF4 antibody 60035-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF,ChIP

Cell Metab

Disrupted methionine cycle triggers muscle atrophy in cancer cachexia through epigenetic regulation of REDD1

Authors - Kai Lin
mouseWB

Nat Commun

Moderate-intensity interval exercise exacerbates cardiac lipotoxicity in high-fat, high-calories diet-fed mice

Authors - Jing Geng
mouseWB,IF

Adv Sci (Weinh)

The Critical Role of The Piezo1/β-catenin/ATF4 Axis on The Stemness of Gli1+ BMSCs During Simulated Microgravity-Induced Bone Loss

Authors - Yuxiang Hu
humanIHC

J Clin Invest

ATF4-dependent induction of heme oxygenase 1 prevents anoikis and promotes metastasis.

Authors - Souvik Dey
mouseIF

Aging Cell

Reducing ER stress with chaperone therapy reverses sleep fragmentation and cognitive decline in aged mice.

Authors - Jennifer M Hafycz
mouseWB,ChIP

Nat Commun

Integration of Hippo signalling and the unfolded protein response to restrain liver overgrowth and tumorigenesis.

Authors - Hongtan Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Morgane (Verified Customer) (10-15-2025)

Works well on Total extract, two bands can be detected. Migration is a little higher than expected

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HCT116
ATF4 Antibody Western Blot validation (1/1000 dilution) in HCT116 (Cat no:60035-1-Ig)
FH

ARUNASALAM (Verified Customer) (10-02-2025)

This ATF4 antibody works well in IHC staining at 1:500 dilution with minimal background on tumor tissues.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human Tumor Tissues
FH

Daniel (Verified Customer) (12-02-2019)

Multiple bands appeared which were higher than the expected ~50kDa.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse kidney
ATF4 Antibody Western Blot, validation (1:1000 dilution) in Mouse kidney (Cat no:60035-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...