• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ATF4 Monoclonal antibody

ATF4 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-60035
Clone No.3E4C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

3E4C5, cAMP-dependent transcription factor ATF-4, CREB2, Cyclic AMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60035 targets ATF4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1279

Product name: Recombinant human ATF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC022088

Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predict reactive species
Full Name activating transcription factor 4 (tax-responsive enhancer element B67)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC022088
Gene Symbol ATF4
Gene ID (NCBI) 468
RRIDAB_2883090
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18848
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. This antibody is a mouse monoclonal antibody raised against full length human ATF4 antigen. The antibody recognizes the 38 kd ATF4 protein and its phosphorylated forms (50 kd). This antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATF4 antibody CL488-60035Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...