• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated ATF4 Monoclonal antibody

ATF4 Monoclonal Antibody for FC (Intra)
Cat No. CL594-60035
Clone No.3E4C5

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, FC (Intra)

3E4C5, cAMP-dependent transcription factor ATF-4, CREB2, Cyclic AMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

CL594-60035 targets ATF4 in WB, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1279

Product name: Recombinant human ATF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC022088

Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predict reactive species
Full Name activating transcription factor 4 (tax-responsive enhancer element B67)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC022088
Gene Symbol ATF4
Gene ID (NCBI) 468
RRIDAB_2883410
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18848
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. This antibody is a mouse monoclonal antibody raised against full length human ATF4 antigen. This anitbody is conjugated with CL594, Ex/Em 593 nm/614 nm.

Publications

SpeciesApplicationTitle
mouseWB

J Clin Invest

Sec13 promotes oligodendrocyte differentiation and myelin repair through autocrine pleiotrophin signaling.

Authors - Zhixiong Liu
mouse

Nature

Bone marrow plasma cells require P2RX4 to sense extracellular ATP

Authors - Masaki Ishikawa
Loading...
||
New chat Able
正在加载,请稍候...