CoraLite®594-conjugated ATOH1 Polyclonal antibody

ATOH1 Polyclonal Antibody for FC (Intra)

Cat No. CL594-21215

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

MATH 1, Helix-loop-helix protein hATH-1, HATH1, Class A basic helix-loop-helix protein 14, bHLHa14

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-21215 targets ATOH1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15615

Product name: Recombinant human ATOH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-354 aa of BC069594

Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS

Predict reactive species
Full Name atonal homolog 1 (Drosophila)
Calculated Molecular Weight 354 aa, 38 kDa
Observed Molecular Weight 38-40 kDa
GenBank Accession NumberBC069594
Gene Symbol ATOH1
Gene ID (NCBI) 474
RRIDAB_2919862
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92858
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATOH1, also named as Protein atonal homolog 1 or BHLHA14, is a 364 amino acid protein, which contains 1 bHLH (basic helix-loop-helix) domain. ATOH1,as a transcriptional regulator in the nucleus activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. ATOH1 plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.

Protocols

Product Specific Protocols
FC protocol for CL594 ATOH1 antibody CL594-21215Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...