Alpha Synuclein Polyclonal antibody, PBS Only

• 

  WB analysis using 10842-1-AP (same clone as 10842-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10842-1-AP (alpha-synuclein antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10842-1-AP (same clone as 10842-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10842-1-AP (Alpha Synuclein antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10842-1-AP (same clone as 10842-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10842-1-AP (SNCA antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10842-1-AP (Alpha Synuclein antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10842-1-AP (Alpha Synuclein antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10842-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10842-1-AP (alpha-synuclein antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 10842-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10842-1-AP (alpha-synuclein antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 10842-1-AP (same clone as 10842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 10842-1-AP (SNCA antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 10842-1-AP (same clone as 10842-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded rat brain tissue using Alpha Synuclein antibody (10842-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 10842-1-AP (same clone as 10842-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Alpha Synuclein antibody (10842-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 10842-1-AP (same clone as 10842-1-PBS)

  Immunofluorescent analysis of SH-SY5Y cells using 10842-1-AP (alpha-synuclein antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10842-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Alpha Synuclein Polyclonal Antibody for WB, IHC, IF/ICC, IF-Fro, ELISA

Cat No. 10842-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-Fro, ELISA

Synonyms

1, a-synuclein, SNCA, Alpha-synuclein, NACP

---

Product Information

10842-1-PBS targets Alpha Synuclein in WB, IHC, IF/ICC, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1285

  Product name: Recombinant human a-Synuclein protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-140 aa of BC013293

  Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

• Full Name: synuclein, alpha (non A4 component of amyloid precursor)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 15-19 kDa
• GenBank Accession Number: BC013293
• Gene Symbol: Alpha Synuclein
• Gene ID (NCBI): 6622
• RRID: AB_2192672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P37840
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha Synuclein (α-syn) is a 14-19 kDa phosphoprotein that is primarily localize to the presynaptic terminals of mature neurons, where it is involved in synaptic function and plasticity. Α-syn has drawn intense interest ever since the late 1990s, when the first α-synuclein missense mutation was identified as a cause of familial Parkinson's disease (PD). Aggregated and hyper-phosphorylated forms of α-syn protein are the pathological hallmark of Lewy body disease, which includes Parkinson's disease (PD), diffuse Lewy body disease (DLBD), and Lewy body variant of Alzheimer's disease (LBV). This antibody can recognize all the isoforms of α-syn.