BCKDHA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• BCKDHA Polyclonal antibody, PBS Only (30028-1-PBS)

• 

  WB analysis using 30028-1-AP (same clone as 30028-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30028-1-AP (BCKDHA antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30028-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 30028-1-AP (same clone as 30028-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 30028-1-AP (BCKDHA antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30028-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 30028-1-AP (same clone as 30028-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 30028-1-AP (BCKDHA antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30028-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 30028-1-AP (same clone as 30028-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 30028-1-AP (BCKDHA antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30028-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

BCKDHA Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30028-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30028-1-PBS targets BCKDHA in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32613

  Product name: Recombinant human BCKDHA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 264-445 aa of BC008933

  Sequence: CRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK

• Full Name: branched chain keto acid dehydrogenase E1, alpha polypeptide
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 42-50 kDa
• GenBank Accession Number: BC008933
• Gene Symbol: BCKDHA
• Gene ID (NCBI): 593
• RRID: AB_2935504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12694
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

branched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), the gene encoding the regulated subunit of BCKDC was only one of two primary susceptibility genes identified that affected the risk of both type 2 diabetes mellitus (T2DM) and obesity (PMID: 25287287). BIX01294 transcriptionally downregulated the transcription of BCKDHA, which is essential for fueling the tricarboxylic acid (TCA) cycle. Studies have shown that KDM3A, a Jumonji histone demethylase, epigenetically regulates BCKDHA expression by binding to the BCKDHA gene promoter (PMID: 34876693). Moreover, at least four genes including BCKDHA, branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), dihydrolipoamide dehydrogenase (DLD), and dihydrolipoamide branched chain transacylase E2 (DBT) have been reported to be the causative gene for Maple syrup urine disease (MSUD) (PMID: 34187135).