• Featured Product
  • KD/KO Validated

BCL6 Recombinant monoclonal antibody

BCL6 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), IP, ELISA, ChIP-qPCR
Cat No. 81754-1-RR
Clone No.3K6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), IP, ELISA, ChIP-qPCR

BCL-6, 3K6, B cell CLL/lymphoma 6, B cell lymphoma 6 protein, B-cell lymphoma 5 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRamos cells, A20 cells, Daudi cells
Positive IP detected inRamos cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inRamos cells
Positive ChIP-qPCR detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
CHIP-QPCRCHIP-QPCR : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81754-1-RR targets BCL6 in WB, IHC, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15519

Product name: Recombinant human BCL6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-532 aa of BC150184

Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS

Predict reactive species
Full Name B-cell CLL/lymphoma 6
Calculated Molecular Weight 706 aa, 79 kDa
Observed Molecular Weight 79-95 kDa
GenBank Accession NumberBC150184
Gene Symbol BCL6
Gene ID (NCBI) 604
RRIDAB_2935576
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41182
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BCL6, a zinc finger transcription factor, contains an N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages.

Protocols

Product Specific Protocols
IHC protocol for BCL6 antibody 81754-1-RRDownload protocol
IP protocol for BCL6 antibody 81754-1-RRDownload protocol
WB protocol for BCL6 antibody 81754-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...