CoraLite® Plus 488-conjugated BCL6 Recombinant monoclonal antibody

BCL6 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. CL488-81754
Clone No.3K6

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

FC (Intra)

B cell CLL/lymphoma 6, B cell lymphoma 5 protein, B cell lymphoma 6 protein, BCL6, LAZ3, Protein LAZ 3, ZBTB27, Zinc finger protein 51, ZNF51

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inRamos cells
Positive FC detected inRamos cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81754 targets BCL6 in FC (Intra) applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15519

Product name: Recombinant human BCL6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-532 aa of BC150184

Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS

Predict reactive species
Full Name B-cell CLL/lymphoma 6
Calculated Molecular Weight 706 aa, 79 kDa
Observed Molecular Weight 79-95 kDa
GenBank Accession NumberBC150184
Gene Symbol BCL6
Gene ID (NCBI) 604
RRIDAB_3084506
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41182
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BCL6, a zinc finger transcription factor, contains an N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BCL6 antibody CL488-81754Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...