• Featured Product
  • KD/KO Validated

BCL6 Recombinant monoclonal antibody, PBS Only

BCL6 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), IP, Indirect ELISA, ChIP-qPCR
Cat No. 81754-1-PBS
Clone No.3K6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), IP, Indirect ELISA, ChIP-qPCR

BCL-6, 3K6, B cell CLL/lymphoma 6, B cell lymphoma 6 protein, B-cell lymphoma 5 protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81754-1-PBS targets BCL6 in WB, IHC, FC (Intra), IP, Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15519

Product name: Recombinant human BCL6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-532 aa of BC150184

Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS

Predict reactive species
Full Name B-cell CLL/lymphoma 6
Calculated Molecular Weight 706 aa, 79 kDa
Observed Molecular Weight 79-95 kDa
GenBank Accession NumberBC150184
Gene Symbol BCL6
Gene ID (NCBI) 604
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41182
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BCL6, a zinc finger transcription factor, contains an N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages.

Loading...
||
New chat Able
正在加载,请稍候...