C7 Monoclonal antibody

• 

  WB analysis of human plasma using 66908-1-Ig

  human plasma were subjected to SDS PAGE followed by western blot with 66908-1-Ig (C7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 66908-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C7 antibody (66908-1-Ig, Clone: 1H9C4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red).

• 

  FC experiment of HepG2 using 66908-1-Ig

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug C7 Monoclonal antibody (66908-1-Ig, Clone:1H9C4) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

C7 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66908-1-Ig

Clone No.1H9C4

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

Complement component C7, complement component 7, 1H9C4

---

Tested Applications

• Positive WB detected in: human plasma tissue
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

66908-1-Ig targets C7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12552

  Product name: Recombinant human C7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 310-690 aa of BC063851

  Sequence: GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ

• Full Name: complement component 7
• Calculated Molecular Weight: 843 aa, 94 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC063851
• Gene Symbol: C7
• Gene ID (NCBI): 730
• RRID: AB_2882235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10643
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C7, a single-chain plasma glycoprotein, is a component of the complement system. It is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C7 serves as a membrane anchor. People with C7 deficiency are prone to bacterial infection.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	IF	Front Cell Dev Biol; Deciphering transcriptome patterns in porcine mesenchymal stem cells promoting phenotypic maintenance and differentiation by key driver genes; Authors - Nadia Khaveh